Petromyzon marinus (sea lamprey): 116938609 Help Entry 116938609         CDS       T09614                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn04060   Cytokine-cytokine receptor interaction pmrn04218   Cellular senescence pmrn04620   Toll-like receptor signaling pathway pmrn04621   NOD-like receptor signaling pathway pmrn04622   RIG-I-like receptor signaling pathway pmrn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmrn00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116938609  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     116938609  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116938609    04621 NOD-like receptor signaling pathway     116938609    04622 RIG-I-like receptor signaling pathway     116938609  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116938609  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmrn04052]     116938609    00536 Glycosaminoglycan binding proteins [BR:pmrn00536]     116938609 Cytokines and neuropeptides [BR:pmrn04052]  Cytokines   Chemokines    116938609 Glycosaminoglycan binding proteins [BR:pmrn00536]  Heparan sulfate / Heparin   Chemokines    116938609 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Ig_J_chain CXCL16 Motif Other DBs NCBI-GeneID:  116938609 NCBI-ProteinID:  XP_032801840 UniProt:  A0AAJ7SNC6 LinkDB All DBs Position 4:complement(10419880..10422177) Genome browser AA seq 102 aa AA seqDB search MTMNAKLLFVLLALALCVGHSQAMSVFGGGRCQCVHVISKFIHPKHFQTMEVIPQSSNCK NVEIIVTMKSTKNQICLNPDAPWVRKVISHILDGAQTPKPTP NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgacgatgaacgccaagctgcttttcgtgcttctcgccctggcgctctgcgtcggacac tcgcaggcgatgtccgtattcgggggaggacggtgtcagtgcgtacacgtgatatccaag ttcatccatcccaagcatttccagacaatggaggtcattccacagagctccaactgcaag aatgtggaaatcatcgtgacgatgaaatccaccaaaaaccagatctgcctgaaccctgat gccccctgggtgaggaaggtgatcagccacattttggacggggctcagacacccaaaccc acgccgtga

DBGET integrated database retrieval system