Petromyzon marinus (sea lamprey): 116948322 Help Entry 116948322         CDS       T09614                                  Name (RefSeq) calmodulin-1-like   KO K02183   calmodulin Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn04020   Calcium signaling pathway pmrn04070   Phosphatidylinositol signaling system pmrn04114   Oocyte meiosis pmrn04218   Cellular senescence pmrn04261   Adrenergic signaling in cardiomyocytes pmrn04270   Vascular smooth muscle contraction pmrn04371   Apelin signaling pathway pmrn04625   C-type lectin receptor signaling pathway pmrn04744   Phototransduction pmrn04910   Insulin signaling pathway pmrn04912   GnRH signaling pathway pmrn04916   Melanogenesis Brite KEGG Orthology (KO) [BR:pmrn00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     116948322    04020 Calcium signaling pathway     116948322    04070 Phosphatidylinositol signaling system     116948322  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116948322    04218 Cellular senescence     116948322  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116948322   09152 Endocrine system    04910 Insulin signaling pathway     116948322    04912 GnRH signaling pathway     116948322    04916 Melanogenesis     116948322   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     116948322    04270 Vascular smooth muscle contraction     116948322   09157 Sensory system    04744 Phototransduction     116948322  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pmrn01009]     116948322   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmrn04131]     116948322    03036 Chromosome and associated proteins [BR:pmrn03036]     116948322   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmrn04147]     116948322 Protein phosphatases and associated proteins [BR:pmrn01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116948322 Membrane trafficking [BR:pmrn04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     116948322 Chromosome and associated proteins [BR:pmrn03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      116948322 Exosome [BR:pmrn04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116948322 SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EH EF_EFCAB10_C SPARC_Ca_bdg EF-hand_11 UPF0154 SAPC2_N EF-hand_EFHB_C Dockerin_1 EFhand_Ca_insen BamM_C FCaBP_EF-hand Caleosin DUF1103 DUF5580_M EF-hand_STIM1 SPEF2_C SurA_N_3 PA_Ig-like Motif Other DBs NCBI-GeneID:  116948322 NCBI-ProteinID:  XP_032820770 UniProt:  S4RL94 LinkDB All DBs Position 33:complement(3059788..3064616) Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGTITVKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDE EVDEMIREADIDGDGQVNYEEFVQMMTAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcagaccagcttacagaagagcaaattgcggagttcaaggaggcgttctcccttttt gacaaggatggcgacggtaccatcactgtcaaggagctgggcaccgtcatgaggtctctg ggccaaaatcccaccgaggctgagctgcaggacatgatcaatgaggtggatgccgatgga aatggaaccattgatttccccgagtttctgacaatgatggcgagaaaaatgaaagacacc gatagtgaggaagagatacgagaagctttccgagtgtttgacaaggatgggaatggctac atcagtgcggcagagctgcgtcacgtcatgacgaacctgggggagaagctcacggacgag gaggtggacgagatgatacgagaggctgacatcgatggagacggacaagtcaactatgaa gaatttgtccaaatgatgacagcaaagtga

DBGET integrated database retrieval system