Petromyzon marinus (sea lamprey): 116950767 Help Entry 116950767         CDS       T09614                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn04382   Cornified envelope formation pmrn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmrn00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     116950767  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116950767  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmrn04147]     116950767 Exosome [BR:pmrn04147]  Exosomal proteins   Exosomal proteins of microglial cells    116950767 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EH HalOD1 Motif Other DBs NCBI-GeneID:  116950767 NCBI-ProteinID:  XP_032824714 UniProt:  A0AAJ7TW77 LinkDB All DBs Position 40:1204963..1211524 Genome browser AA seq 101 aa AA seqDB search MAQPKLDGIIKDIVLVFNAYSSESGDATTLSKEELGELMRSELPGFLNQLDPGMLDQLMQ DLDTDEDGQVNFQEFMSLLSIITIQCDEEYMKLKQKKGGRS NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggcccaacccaaactggacggaatcattaaagacattgtattggtgttcaacgcctat tcttccgagtctggcgacgcgaccacgctcagcaaagaggagcttggggaattaatgcgc tctgagctccctggattcctgaatcagctcgatccggggatgctggaccagttgatgcag gaccttgacacggacgaggacggccaagtgaacttccaggagttcatgtccttgttgagc atcatcaccatccagtgcgacgaggaatacatgaagctcaagcagaagaagggggggcga tcctga

DBGET integrated database retrieval system