Petromyzon marinus (sea lamprey): 116952352 Help Entry 116952352         CDS       T09614                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn04137   Mitophagy - animal pmrn04140   Autophagy - animal pmrn04144   Endocytosis pmrn04145   Phagosome pmrn04148   Efferocytosis pmrn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmrn00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116952352 (RAB7A)    04145 Phagosome     116952352 (RAB7A)    04140 Autophagy - animal     116952352 (RAB7A)    04137 Mitophagy - animal     116952352 (RAB7A)    04148 Efferocytosis     116952352 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116952352 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmrn04131]     116952352 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmrn04147]     116952352 (RAB7A)    04031 GTP-binding proteins [BR:pmrn04031]     116952352 (RAB7A) Membrane trafficking [BR:pmrn04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     116952352 (RAB7A) Exosome [BR:pmrn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116952352 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    116952352 (RAB7A)   Exosomal proteins of colorectal cancer cells    116952352 (RAB7A)   Exosomal proteins of bladder cancer cells    116952352 (RAB7A) GTP-binding proteins [BR:pmrn04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     116952352 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  116952352 NCBI-ProteinID:  XP_032827519 UniProt:  A0AAJ7U1K7 LinkDB All DBs Position 46:6475074..6487905 Genome browser AA seq 204 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTQPGTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDMENRQVPTKRAQTWCQNKNDVPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPDQIKLTNNDKPKSSSCC NT seq 615 nt NT seq  +upstreamnt  +downstreamnt atgacttcccgcaagaaggttctgctcaaggtgataattctcggagactctggggtgggg aagacgtcgctcatgaaccagtacgtgaacaagaaattcagcaaccagtacaaagcgacc atcggcgcggacttcctcaccaaggaagtgatggtggacgacaggctcgtcaccatgcag atctgggacacagcagggcaggagcggttccagtcgctgggcgtggcgttctaccgcggc gccgactgttgtgtgctcgttttcgacgtgacgcagcccggcacgttcaagacgctggac agctggcgcgacgagttcctcatccaggcgtcaccacgtgaccccgagaacttccccttc gtggtgcttggcaacaagatcgacatggagaacagacaggtcccgacgaagcgcgcccag acctggtgtcagaacaagaacgacgtcccctactttgagacgagcgccaaggaggcgatc aacgtggagcaggccttccagaccatcgctcgcaacgcgctcaaacaggagacggaggtg gagctgtataacgagtttcccgatcagatcaagttgaccaacaacgacaaaccaaaatcc agcagctgctgctag

DBGET integrated database retrieval system