Petromyzon marinus (sea lamprey): 116952355 Help Entry 116952355         CDS       T09614                                  Symbol ARF4 Name (RefSeq) ADP-ribosylation factor 4   KO K07939   ADP-ribosylation factor 4 Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn04144   Endocytosis Brite KEGG Orthology (KO) [BR:pmrn00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116952355 (ARF4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmrn04131]     116952355 (ARF4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmrn04147]     116952355 (ARF4)    04031 GTP-binding proteins [BR:pmrn04031]     116952355 (ARF4) Membrane trafficking [BR:pmrn04131]  Endosome - Golgi transport   Arf GTPases and associated proteins    Arf GTPases     116952355 (ARF4) Exosome [BR:pmrn04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116952355 (ARF4)   Exosomal proteins of other body fluids (saliva and urine)    116952355 (ARF4)   Exosomal proteins of colorectal cancer cells    116952355 (ARF4) GTP-binding proteins [BR:pmrn04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     116952355 (ARF4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Arf Roc SRPRB Ras G-alpha Gtr1_RagA MMR_HSR1 6PF2K GTP_EFTU Csa3_N FLAD1_M YgzA cobW L27 SRP54 RXYLT1_N CRISPR_Cas2 AAA_18 Motif Other DBs NCBI-GeneID:  116952355 NCBI-ProteinID:  XP_032827522 UniProt:  A0AAJ7U3C8 LinkDB All DBs Position 46:complement(6291029..6310588) Genome browser AA seq 180 aa AA seqDB search MGLTISSLFTRLLGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN ICFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERTQEAAEELQKMLQEDELRSAV LLVFANKQDLPNAMTISDLTEKLGLQGLRNRTWYVQATCATQGSGLYEGLDWLSNELSKH NT seq 543 nt NT seq  +upstreamnt  +downstreamnt atggggctgacgatttcctcgctgttcacgaggctgctcggcaagaagcagatgcggatc ctgatggttggccttgacgctgccggaaagacgacgatcctgtacaagctgaagctggga gagatcgtgaccaccatccccaccatcggcttcaacgtggagacggtggagtacaagaac atctgcttcacggtgtgggacgtcggagggcaggacaagatccgacccctgtggaggcac tacttccagaacacgcagggcctgatattcgttgttgacagcaacgatcgcgagaggacg caggaggccgccgaggagctgcagaaaatgctgcaagaggatgagctgaggagcgcggtg ctgctggtgtttgcgaacaagcaggatctccccaatgccatgaccatcagcgacctcacc gagaagctgggcctgcagggactgcgcaaccgcacttggtacgtgcaggcgacgtgcgcc acgcagggaagcggcctctacgaaggactcgactggctctccaacgagctctccaagcat tag

DBGET integrated database retrieval system