Petromyzon marinus (sea lamprey): 116953569 Help Entry 116953569         CDS       T09614                                  Symbol S100A1 Name (RefSeq) protein S100-A1 isoform X1   KO K17274   protein S100-A10 Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn04382   Cornified envelope formation pmrn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmrn00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     116953569 (S100A1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116953569 (S100A1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmrn04147]     116953569 (S100A1) Exosome [BR:pmrn04147]  Exosomal proteins   Exosomal proteins of microglial cells    116953569 (S100A1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EH EF-hand_FSTL1 Motif Other DBs NCBI-GeneID:  116953569 NCBI-ProteinID:  XP_032829781 UniProt:  A0AAJ7U4N9 LinkDB All DBs Position 52:683298..718284 Genome browser AA seq 102 aa AA seqDB search MSVSNLEQVMQDLISVFHQYAGKEGNKYTLSKHELKDLVSHELAGFLKGKKDPTTVDKLL KDLDADGDGELDFSEFAAMVASFTIACNVYFEDYLKTQAAAK NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtcggtgtccaacctggagcaggtgatgcaggacttgatctcggtgttccaccagtac gccggcaaggagggcaacaagtacacgctgagcaagcacgagctcaaggacctcgtgtct cacgagctggcgggcttcctcaagggcaagaaggaccccaccaccgtggacaagctgctc aaggacctggacgcggacggcgatggggagctggacttctcagagttcgccgccatggtg gcctccttcaccatcgcgtgcaacgtctactttgaggactacctcaagacccaggccgct gccaagtga

DBGET integrated database retrieval system