Petromyzon marinus (sea lamprey): 116953663 Help Entry 116953663         CDS       T09614                                  Name (RefSeq) UPF0691 protein C9orf116 homolog   KO K28114   piercer of microtubule wall 2 protein Organism pmrn  Petromyzon marinus (sea lamprey) Brite KEGG Orthology (KO) [BR:pmrn00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:pmrn03037]     116953663 Cilium and associated proteins [BR:pmrn03037]  Motile cilia and associated proteins   Other motile cilia associated proteins    116953663 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PIRC1_2 Motif Other DBs NCBI-GeneID:  116953663 NCBI-ProteinID:  XP_032829950 UniProt:  A0AAJ7U787 LinkDB All DBs Position 52:9138649..9142560 Genome browser AA seq 98 aa AA seqDB search MMSEAGTAGPGLGSPSPGNPVFTVRAGAAPPASSLYRTTAHDYGALSPGPEAAPCVHRPA SQRFSRHLGECGMPRDRALNTTLDRSRVIDHPNFQHTL NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgatgtcggaggcgggcacggccgggccgggcctcggcagcccgagcccgggcaacccg gtgttcacggtgcgcgccggggccgcgccgcccgcctcctcgctctaccgcaccacggcg cacgactacggcgccctgagccccgggcccgaggcggcgccgtgcgtgcaccgccccgcg tcgcagcgcttctcgcggcacctcggggagtgcgggatgccccgcgaccgggccctcaac acgaccctggaccgcagccgcgtcatcgaccaccccaacttccagcacacgctctga

DBGET integrated database retrieval system