Petromyzon marinus (sea lamprey): 116955764 Help Entry 116955764         CDS       T09614                                  Symbol RRAS2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn04010   MAPK signaling pathway pmrn04137   Mitophagy - animal pmrn04140   Autophagy - animal pmrn04218   Cellular senescence pmrn04371   Apelin signaling pathway pmrn04625   C-type lectin receptor signaling pathway pmrn04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:pmrn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116955764 (RRAS2)    04371 Apelin signaling pathway     116955764 (RRAS2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116955764 (RRAS2)    04137 Mitophagy - animal     116955764 (RRAS2)   09143 Cell growth and death    04218 Cellular senescence     116955764 (RRAS2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116955764 (RRAS2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116955764 (RRAS2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmrn04147]     116955764 (RRAS2)    04031 GTP-binding proteins [BR:pmrn04031]     116955764 (RRAS2) Exosome [BR:pmrn04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116955764 (RRAS2)   Exosomal proteins of bladder cancer cells    116955764 (RRAS2) GTP-binding proteins [BR:pmrn04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116955764 (RRAS2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 Motif Other DBs NCBI-GeneID:  116955764 NCBI-ProteinID:  XP_032832958 UniProt:  A0AAJ7XH06 LinkDB All DBs Position 3:complement(17195080..17253256) Genome browser AA seq 201 aa AA seqDB search MAAKDGATQDKHKIVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDDRAAR LDILDTAGQEEFGAMREQYMRTGEGFLLVFSITERGSFDEIYKFHRQILRVKDRDEFPMI LVGNKADLDHQRQVTQEEGQQLARSLKIPYMEASAKVRLNVDQAFHELVRVIRKFQVDEC PPSSEPPTKESTENGCRCVIL NT seq 606 nt NT seq  +upstreamnt  +downstreamnt atggcggctaaggacggggcgacgcaagacaagcacaagatcgtggtggtcggtggtggc ggcgtgggcaagagcgcgctcaccatccagttcatacagtcgtacttcgtcacggactac gaccccaccatcgaggactcgtacacgaagcagtgcgtcatcgacgaccgggctgcacga ctcgacatccttgacacggccgggcaggaggagtttggggccatgcgtgagcagtacatg cggacgggcgagggcttcctcctcgtcttctccatcacggagcgcggcagctttgatgaa atctacaaattccaccggcaaatcctgcgcgtgaaagaccgggacgagttccccatgatc ctcgtcggcaacaaagcggatctcgatcaccagcgccaggtgacgcaggaggagggacag cagctcgctcgctccctcaagatcccctacatggaggcgtcggccaaggtgcgactcaac gtggaccaggccttccacgaactcgtcagggtcatacggaagttccaggtggacgagtgc ccgccttcctcggagccacccacaaaggagtcgaccgagaacggctgccgctgcgtcatc ctctaa

DBGET integrated database retrieval system