Petromyzon marinus (sea lamprey): 116958096 Help Entry 116958096         CDS       T09614                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn04010   MAPK signaling pathway pmrn04068   FoxO signaling pathway pmrn04081   Hormone signaling pmrn04114   Oocyte meiosis pmrn04140   Autophagy - animal pmrn04150   mTOR signaling pathway pmrn04810   Regulation of actin cytoskeleton pmrn04910   Insulin signaling pathway pmrn04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:pmrn00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116958096 (INS)    04068 FoxO signaling pathway     116958096 (INS)    04150 mTOR signaling pathway     116958096 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     116958096 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116958096 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     116958096 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116958096 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     116958096 (INS)    04914 Progesterone-mediated oocyte maturation     116958096 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:pmrn04052]     116958096 (INS) Cytokines and neuropeptides [BR:pmrn04052]  Neuropeptides   Unclassified    116958096 (INS) SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  116958096 NCBI-ProteinID:  XP_032836479 UniProt:  A0AAJ7XJ00 LinkDB All DBs Position 3:5473937..5476592 Genome browser AA seq 179 aa AA seqDB search MHLCVAGCEPPAWATSLTPQYSPTPVLLQPLHHHPPPTMSPRSPRAPSAMLTLLLLLPAL LLLLLSLMSPVPAHASALTGAGGTHLCGSHLVEALYVVCGDRGFFYTPSKTRRELSDVIR TEADAGEQQGGVVAEGEGELWGGAAAPGAREESPRTRRGIVEQCCHRKCSIYDMENYCN NT seq 540 nt NT seq  +upstreamnt  +downstreamnt atgcatctctgcgttgccggctgcgagccacccgcatgggctacctctctaacgccgcaa tattcccccacgcctgtcctgttgcagcctctccaccaccacccaccacccacgatgtca ccacgttctccgagggcgccgtctgccatgctcaccctgctgctgctgctgcccgcgctg ctgctgctgctgctgtcgctgatgagtccggtacccgcccacgcgtcggcgctgacgggc gccggcggcacgcacctgtgcggctcgcacctggtggaggcgctctacgtggtgtgcggc gaccgcggcttcttctacacgcccagcaagacgcgcagggagctgtctgacgtcatccgg accgaggccgacgccggcgagcagcaggggggggtggtggcggagggcgagggcgagctg tggggaggcgccgctgctccgggcgcccgagaagagagcccgaggactcggcgcggtatc gtggagcaatgctgccaccgcaagtgctccatctacgacatggagaactactgcaactga

DBGET integrated database retrieval system