Petromyzon marinus (sea lamprey): 116958776 Help Entry 116958776         CDS       T09614                                  Name (RefSeq) myosin light chain 5-like   KO K12754   myosin regulatory light chain 7 Organism pmrn  Petromyzon marinus (sea lamprey) Pathway pmrn04510   Focal adhesion pmrn04520   Adherens junction pmrn04810   Regulation of actin cytoskeleton pmrn04814   Motor proteins pmrn04820   Cytoskeleton in muscle cells pmrn05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmrn00001]  09140 Cellular Processes   09144 Cellular community - eukaryotes    04510 Focal adhesion     116958776    04520 Adherens junction     116958776   09142 Cell motility    04814 Motor proteins     116958776    04820 Cytoskeleton in muscle cells     116958776    04810 Regulation of actin cytoskeleton     116958776  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116958776  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pmrn04812]     116958776 Cytoskeleton proteins [BR:pmrn04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Myosins      116958776 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF_EFCAB10_C AIF-1 Motif Other DBs NCBI-GeneID:  116958776 NCBI-ProteinID:  XP_032837383 UniProt:  A0AAJ7XL71 LinkDB All DBs Position 83 Genome browser AA seq 154 aa AA seqDB search MVKKANTVKFDEAQMKDFKDVFTIMDRNRDGVIDKNDLRQTFVAIGKSVGDGELNELMKE SPGPLNFDTFLSIFGAKLSGTDNEETLLNSFAMFDNSGKGNINFEEFKVYLTRWADKFNA EELEQMTKLAPISGSGVLDYHALCYTITHGDDKD NT seq 465 nt NT seq  +upstreamnt  +downstreamnt atggttaaaaaggcgaacacggtgaagtttgatgaagcacaaatgaaagactttaaggat gtcttcaccatcatggaccgtaaccgggacggagtcattgacaagaacgacctcagacaa acttttgtagccatcggtaagagtgtgggtgacggagagctgaatgagctgatgaaagag tccccaggacctctcaactttgacacgttcctgtccatcttcggggccaagctcagtggc acagacaatgaggagactctgctcaactccttcgcgatgtttgacaacagcggaaaggga aacatcaacttcgaagagttcaaggtttacctgacccgctgggctgataaattcaatgcg gaggagttggaacagatgaccaagctggcccccatcagtgggagtggcgtcctggactac cacgccctctgctacaccatcacgcacggcgacgacaaggactga

DBGET integrated database retrieval system