Paenibacillus mucilaginosus KNP414: KNP414_05511 Help Entry KNP414_05511      CDS       T01550                                  Name (GenBank) hypothetical protein   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism pms  Paenibacillus mucilaginosus KNP414 Brite KEGG Orthology (KO) [BR:pms00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     KNP414_05511 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda Motif Other DBs NCBI-ProteinID:  AEI44035 UniProt:  F8FJZ4 LinkDB All DBs Position 6097869..6098006 Genome browser AA seq 45 aa AA seqDB search MNHSLEKLSDEDLLEAYLLALDLKLEPSFIRLLRDEIDRRQLHMD NT seq 138 nt NT seq  +upstreamnt  +downstreamnt ttgaatcattcccttgaaaaattatcggatgaagatcttctggaggcctatctcctggct ctcgatttgaaactggagcccagcttcatccgcttgctgcgggatgaaatcgaccgcaga caactccatatggattga

DBGET integrated database retrieval system