Paenibacillus mucilaginosus KNP414: KNP414_07053 Help Entry KNP414_07053      CDS       T01550                                  Name (GenBank) acyl carrier protein   KO K24111   aryl carrier protein AsbD Organism pms  Paenibacillus mucilaginosus KNP414 Pathway pms00975   Biosynthesis of various siderophores pms01100   Metabolic pathways pms01110   Biosynthesis of secondary metabolites Module pms_M01060   Petrobactin biosynthesis, spermidine => petrobactin Brite KEGG Orthology (KO) [BR:pms00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00975 Biosynthesis of various siderophores     KNP414_07053  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:pms01008]     KNP414_07053 Polyketide biosynthesis proteins [BR:pms01008]  Nonribosomal peptide synthetase (NRPS)   Nonlinear NRPS    Petrobacin synthetase     KNP414_07053 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding NEMO SepA Motif Other DBs NCBI-ProteinID:  AEI45565 LinkDB All DBs Position complement(7746775..7747059) Genome browser AA seq 94 aa AA seqDB search MNREELRQGLKRLLTENLELPEAAKRETLDDSLKLNADLYVDSVRLLQLIVYIEEELKLA VPEEELDFKGLDTVGALLDFMAELRPLDAAGQGV NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaaccgcgaggaattaagacaaggcctgaagcgcctgttgacggagaacctggagctg ccggaagcggcgaagcgggagaccctggacgattcgctgaagctgaatgcggatctctat gtggattccgtacggctgctgcagctgatcgtgtacatagaagaagaactgaagctggcg gtgcccgaggaagagctggacttcaaggggctggatacggtcggcgcactgctggacttc atggcggagctgcggccgctggatgcggcggggcagggcgtatga

DBGET integrated database retrieval system