Paenibacillus mucilaginosus KNP414: KNP414_07400 Help Entry KNP414_07400      CDS       T01550                                  Symbol gcvH2 Name (GenBank) GcvH2   KO K02437   glycine cleavage system H protein Organism pms  Paenibacillus mucilaginosus KNP414 Pathway pms00260   Glycine, serine and threonine metabolism pms00630   Glyoxylate and dicarboxylate metabolism pms00670   One carbon pool by folate pms00785   Lipoic acid metabolism pms01100   Metabolic pathways pms01110   Biosynthesis of secondary metabolites pms01200   Carbon metabolism Brite KEGG Orthology (KO) [BR:pms00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     KNP414_07400 (gcvH2)   09105 Amino acid metabolism    00260 Glycine, serine and threonine metabolism     KNP414_07400 (gcvH2)   09108 Metabolism of cofactors and vitamins    00785 Lipoic acid metabolism     KNP414_07400 (gcvH2)    00670 One carbon pool by folate     KNP414_07400 (gcvH2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GCV_H Biotin_lipoyl RnfC_N DREPP BSH_RND GP70 Motif Other DBs NCBI-ProteinID:  AEI45904 UniProt:  F8FPT7 LinkDB All DBs Position complement(8100590..8100991) Genome browser AA seq 133 aa AA seqDB search MSEVKAELLYSEDHEWAAEAESGTVRVGITDFAQRELGDIVFVELPGVGAVVEAGGSLGT IESVKTVSDLYAPVSGRVVKVNEALLERPEQVNEDPYGAGWVVELAIEGTLKQAGAHLLT AEGYLAHIDSLNE NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgagcgaggtaaaggcggaactgctgtacagtgaagatcatgagtgggccgcggaggcg gagagcggaacggttcgtgtcggcatcaccgattttgcccagcgggagctcggggatatc gtattcgtggagcttcccggggtcggtgcggtggtggaagcggggggaagcctcggcacc atcgagtccgtgaagacggtctcggatctgtacgctcctgtgagcggacgcgtagtgaag gtcaacgaggcgctgctcgaacgccccgaacaggtgaacgaggatccgtacggggccggc tgggtggtggagctggcgatcgaggggacactgaagcaggcaggcgcgcatctgctcacc gccgaaggctatctcgcgcatatcgattcgctgaatgaatag

DBGET integrated database retrieval system