Paenibacillus mucilaginosus KNP414: KNP414_07634 Help Entry KNP414_07634      CDS       T01550                                  Name (GenBank) hypothetical protein   KO K06317   inhibitor of the pro-sigma K processing machinery Organism pms  Paenibacillus mucilaginosus KNP414 Brite KEGG Orthology (KO) [BR:pms00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     KNP414_07634 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  BofA DUF5963 Motif Other DBs NCBI-ProteinID:  AEI46121 UniProt:  F8FCN0 LinkDB All DBs Position complement(8326136..8326402) Genome browser AA seq 88 aa AA seqDB search MKTVILWSVLIGSGVILGGVLLRNRFAFQWLGRICLHLAFASILLYILNLFSGYTHIELP LNAVTVGTVSVLGLPGLAALAALKLWVV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgaaaacggtgatcttatggagcgtattgattggatcgggcgtgatcttagggggcgtt ctgctgaggaaccgttttgcatttcaatggctcggcaggatttgtttgcatcttgccttc gcttcgatcctgttatatattcttaacctgttcagcggctacactcatattgagcttcca ctcaatgcggtaacggtagggaccgtcagcgttctggggcttcccgggctggctgctctg gcggccttgaagctgtgggtagtgtga

DBGET integrated database retrieval system