Prochlorococcus marinus MIT 9313: PMT_2423 Help Entry PMT_2423          CDS       T00143                                  Name (GenBank) Conserved hypothetical protein   KO K03666   host factor-I protein Organism pmt  Prochlorococcus marinus MIT 9313 Pathway pmt02024   Quorum sensing pmt03018   RNA degradation Brite KEGG Orthology (KO) [BR:pmt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PMT_2423  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PMT_2423  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmt03019]     PMT_2423    03036 Chromosome and associated proteins [BR:pmt03036]     PMT_2423 Messenger RNA biogenesis [BR:pmt03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PMT_2423 Chromosome and associated proteins [BR:pmt03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PMT_2423 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq_1 Hfq Motif Other DBs NCBI-ProteinID:  CAX31941 UniProt:  B9ERA0 LinkDB All DBs Position complement(775224..775445) Genome browser AA seq 73 aa AA seqDB search MEPPPLNPSLPGIRLIQSWVRDEIPLSLELADGLRLEGRLLWQDPEFLALERPGSSQPVL INRRAVLIIRPLG NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggagcccccccctctcaatcccagccttccagggattcgtctgattcagagttgggtt agggacgagatccctctcagtcttgaattagctgatgggctccgattggaaggccgcttg ctttggcaggacccggaattccttgccctggaacggcctggatcgagtcaacctgtactg attaaccgtcgggctgtactgataattcgtccactgggctaa

DBGET integrated database retrieval system