Podarcis muralis (common wall lizard): 114581772 Help Entry 114581772         CDS       T06059                                  Name (RefSeq) histone H2A type 2-C-like   KO K11251   histone H2A Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua03082   ATP-dependent chromatin remodeling pmua04217   Necroptosis Brite KEGG Orthology (KO) [BR:pmua00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     114581772  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     114581772  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmua03036]     114581772   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmua04147]     114581772 Chromosome and associated proteins [BR:pmua03036]  Eukaryotic type   Nucleosome assembly factors    Histones     114581772 Exosome [BR:pmua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114581772 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  114581772 NCBI-ProteinID:  XP_028558160 UniProt:  A0A670J9B2 LinkDB All DBs Position 13:complement(45435980..45436499) Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK TESHKAKGK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggacgtggcaagcaaggaggcaaggctcgggccaaggccaagactcgctcttct cgtgccggactccagttccccgtgggtcgtgtgcaccgtcttctgcgcaaagggaactac gcagagcgcgtcggggccggggcgcccgtctacttggctgctgtgctggagtacctgact gctgagatcctggagttggccggcaacgctgcccgggacaacaagaagaccaggatcatc cctcgccacttgcagctcgccatccgcaacgacgaggagctgaacaagctgctgggcaaa gtcaccattgctcaaggaggcgtcctccccaacatccaggctgtgctgttgcccaagaaa accgagagccacaaggccaaaggaaaatag

DBGET integrated database retrieval system