Podarcis muralis (common wall lizard): 114588755 Help Entry 114588755         CDS       T06059                                  Name (RefSeq) protein S100-A10-like   KO K17274   protein S100-A10 Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua04382   Cornified envelope formation pmua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmua00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     114588755  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114588755  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmua04147]     114588755 Exosome [BR:pmua04147]  Exosomal proteins   Exosomal proteins of microglial cells    114588755 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EFhand_Ca_insen EF-hand_7 EF-hand_6 Motif Other DBs NCBI-GeneID:  114588755 NCBI-ProteinID:  XP_028570018 LinkDB All DBs Position Z:complement(48399448..48400352) Genome browser AA seq 99 aa AA seqDB search MPSQLEHAMENIMFTFHKFAGDKNYLTKDDLRQLMEKEVPGYMENQKDPMAIDRIMKNLE ECRDGKVNFEGYLSLIAGLTNGCNEYYVKKMKPTGVKKY NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgccatcccagctagaacacgccatggagaatatcatgttcactttccacaaatttgcg ggtgacaagaactatctgacgaaggatgatcttcggcagttgatggagaaggaagtccct gggtatatggaaaaccagaaagatccgatggccatcgaccgaatcatgaaaaacctagaa gagtgtcgggatggcaaagtcaactttgagggctacctctctctcattgctgggctgacc aatggatgcaacgagtattacgtgaagaagatgaagccaacgggagtcaagaagtattga

DBGET integrated database retrieval system