Podarcis muralis (common wall lizard): 114589734 Help Entry 114589734         CDS       T06059                                  Name (RefSeq) GTP-binding protein Rheb-like   KO K07208   Ras homolog enriched in brain Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua04140   Autophagy - animal pmua04150   mTOR signaling pathway pmua04218   Cellular senescence pmua04910   Insulin signaling pathway pmua05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:pmua00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     114589734  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     114589734   09143 Cell growth and death    04218 Cellular senescence     114589734  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     114589734  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     114589734  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:pmua04031]     114589734 GTP-binding proteins [BR:pmua04031]  Small (monomeric) G-proteins   Ras Family    Rheb     114589734 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc MMR_HSR1 Arf GTP_EFTU AAA_14 STIV_penton_2nd Motif Other DBs NCBI-GeneID:  114589734 NCBI-ProteinID:  XP_028571996 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MPPSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQVVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKDISVGDSNFLLRAAD NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgccgccgtccaagtcccgtaagatcgccatcctgggctacaggagcgtcgggaaatca tcgttgacgattcagtttgtggaaggccagttcgttgattcatatgatcctaccatagag aacacattcacaaagctgattacagtaaatgggcaggaatatcatcttcaagtagttgac acagctggccaagatgaatactcaatatttcctcagacgtactccatagacattaatgga tacattcttgtttactcagtcacatcaataaaagacataagtgtaggtgattctaacttc cttttgagagcagcagactga

DBGET integrated database retrieval system