Podarcis muralis (common wall lizard): 114590118 Help Entry 114590118         CDS       T06059                                  Name (RefSeq) metallothionein   KO K14739   metallothionein 1/2 Organism pmua  Podarcis muralis (common wall lizard) Brite KEGG Orthology (KO) [BR:pmua00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmua03019]     114590118    03029 Mitochondrial biogenesis [BR:pmua03029]     114590118 Messenger RNA biogenesis [BR:pmua03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      114590118 Mitochondrial biogenesis [BR:pmua03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     114590118 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  114590118 NCBI-ProteinID:  XP_028572312 LinkDB All DBs Position Unknown AA seq 63 aa AA seqDB search MDPQDCACATGGSCSCAGSCKCKNCKCTSCKKSCCSCCPAGCAKCAKNCVCKEPLSDKCS CCT NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggatcctcaggactgcgcttgcgccactggtggctcttgttcctgtgccggctcctgc aaatgcaaaaattgcaaatgcacttcatgcaaaaaaagctgctgctcttgttgcccagct ggatgcgccaaatgtgctaagaattgtgtctgcaaagagccactgtcggataaatgcagc tgctgcacctaa

DBGET integrated database retrieval system