Podarcis muralis (common wall lizard): 114591724 Help Entry 114591724         CDS       T06059                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua04137   Mitophagy - animal pmua04140   Autophagy - animal pmua04144   Endocytosis pmua04145   Phagosome pmua04148   Efferocytosis pmua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmua00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114591724 (RAB7A)    04145 Phagosome     114591724 (RAB7A)    04140 Autophagy - animal     114591724 (RAB7A)    04137 Mitophagy - animal     114591724 (RAB7A)    04148 Efferocytosis     114591724 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114591724 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmua04131]     114591724 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmua04147]     114591724 (RAB7A)    04031 GTP-binding proteins [BR:pmua04031]     114591724 (RAB7A) Membrane trafficking [BR:pmua04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     114591724 (RAB7A) Exosome [BR:pmua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114591724 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    114591724 (RAB7A)   Exosomal proteins of colorectal cancer cells    114591724 (RAB7A)   Exosomal proteins of bladder cancer cells    114591724 (RAB7A) GTP-binding proteins [BR:pmua04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     114591724 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  114591724 NCBI-ProteinID:  XP_028574998 LinkDB All DBs Position 2:complement(83964412..83993153) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtattactcaaagtcatcatccttggcgactcgggggtggga aagacatctctcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaagctaca ataggagccgacttcctcacaaaggaagtgatggtggatgacaggctagtcacaatgcag atatgggatacagcaggacaggaacggtttcagtctctgggagtagccttctacagagga gcagactgctgcgtgctggtgtttgatgtaacggctcccaacacatttaaaactctcgac agctggcgagatgagtttctcattcaagccagtccgcgggatcctgagaactttcctttt gttgtgctgggaaacaagattgaccttgaaaacagacaagttactacaaaacgagcacag gcctggtgctacagcaaaaacaatatcccttattttgaaaccagtgccaaggaggccatt aacgtggaacaggctttccaaacaattgcacgaaatgcacttaagcaggaaactgaagtg gagctttacaacgaatttcctgaacctatcaaactagacaagaatgaccgggcgaaagcc tctgcggagagctgcagctgctga

DBGET integrated database retrieval system