Podarcis muralis (common wall lizard): 114592274 Help Entry 114592274         CDS       T06059                                  Symbol ARF6 Name (RefSeq) ADP-ribosylation factor 6   KO K07941   ADP-ribosylation factor 6 Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua04144   Endocytosis pmua04517   IgSF CAM signaling pmua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmua00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     114592274 (ARF6)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114592274 (ARF6)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114592274 (ARF6)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmua04131]     114592274 (ARF6)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmua04147]     114592274 (ARF6)    04031 GTP-binding proteins [BR:pmua04031]     114592274 (ARF6) Membrane trafficking [BR:pmua04131]  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     114592274 (ARF6)   Arf GTPases and associated proteins    Arf GTPases     114592274 (ARF6) Exosome [BR:pmua04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    114592274 (ARF6)   Exosomal proteins of colorectal cancer cells    114592274 (ARF6) GTP-binding proteins [BR:pmua04031]  Small (monomeric) G-proteins   Arf/Sar Family    Arf [OT]     114592274 (ARF6) SSDB OrthologParalogGFIT Motif Pfam:  Arf Roc G-alpha Ras SRPRB Gtr1_RagA MMR_HSR1 GTP_EFTU 6PF2K SpoOE-like CRISPR_Cas2 Motif Other DBs NCBI-GeneID:  114592274 NCBI-ProteinID:  XP_028576203 UniProt:  A0A670HM40 LinkDB All DBs Position 1:3362953..3367617 Genome browser AA seq 175 aa AA seqDB search MGKVLSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQAVTTIPTVGFNVETVTYKNVKFN VWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIF ANKQDLPDAMKPHEIQEKLGLTRIRDRNWYVQPSCATSGDGLYEGLTWLTSNYKS NT seq 528 nt NT seq  +upstreamnt  +downstreamnt atgggcaaggtgctgtccaagatctttggcaacaaggagatgcggatcctgatgctggga ctggacgcggcgggcaagaccaccatcctgtacaaactcaagctgggccaggcggtcacc accatccccaccgtgggcttcaacgtggagaccgtgacttacaaaaacgtcaagtttaac gtgtgggacgtcgggggccaggataagatccggccgctctggcggcactactacacgggc acccagggcctgatctttgtggtggactgcgctgaccgggaccgcatagacgaggcccgg caggagttgcaccgcatcatcaacgaccgggagatgcgggatgccatcatccttatcttt gccaacaagcaggaccttcctgacgccatgaagccgcacgagatccaagagaaactaggc ctgacccgaatcagggataggaattggtatgttcagccgtcctgtgccacctcgggagac ggactctacgaagggctgacatggttaacatctaactataaatcctaa

DBGET integrated database retrieval system