Podarcis muralis (common wall lizard): 114597878 Help Entry 114597878         CDS       T06059                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua04810   Regulation of actin cytoskeleton pmua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmua00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     114597878 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114597878 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmua04131]     114597878 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:pmua04812]     114597878 (PFN2)    04147 Exosome [BR:pmua04147]     114597878 (PFN2) Membrane trafficking [BR:pmua04131]  Others   Actin-binding proteins    Others     114597878 (PFN2) Cytoskeleton proteins [BR:pmua04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      114597878 (PFN2) Exosome [BR:pmua04147]  Exosomal proteins   Proteins found in most exosomes    114597878 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  114597878 NCBI-ProteinID:  XP_028587115 LinkDB All DBs Position 5:complement(75669160..75675952) Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH GGGLNKKAYSMAKYLRDSGF NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggcaggctggcagagctacgtggataacctgatgtgcgatggctgctgccaggaggcc gccattgtcggctactgtgacgccaagtacgtctgggcagcgacggccgggggcatcttt cagagcattacgcctgtagaaatagatatgattgtaggaaaagaccgcgagggtttcttc accaatggtctaactctgggtgcaaagaagtgctctgtgatcagagatagcctctatgtg gatggtgactgtacaatggacatcaggacaaagagccaaggtggcgagccaacatataat gttgctgtaggcagagctggtcgagtcttggtctttgtaatgggcaaagaaggggtccat ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc tag

DBGET integrated database retrieval system