Podarcis muralis (common wall lizard): 114598372 Help Entry 114598372         CDS       T06059                                  Name (RefSeq) metallothionein-like   KO K14739   metallothionein 1/2 Organism pmua  Podarcis muralis (common wall lizard) Brite KEGG Orthology (KO) [BR:pmua00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmua03019]     114598372    03029 Mitochondrial biogenesis [BR:pmua03029]     114598372 Messenger RNA biogenesis [BR:pmua03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      114598372 Mitochondrial biogenesis [BR:pmua03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     114598372 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  114598372 NCBI-ProteinID:  XP_028587877 LinkDB All DBs Position 6:complement(71558856..71559047) Genome browser AA seq 63 aa AA seqDB search MDLQDCACTTGGSCSCAGSCKCKNWKCTSCKKCCCSFCPAGCNKCAKGCVCKEALSDKCS CCH NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggatcttcaggactgcgcctgcaccactggtggctcttgttcctgtgccggctcctgc aaatgcaaaaattggaaatgtacttcatgcaaaaaatgctgctgctccttttgcccagct ggatgcaacaaatgtgccaagggttgtgtctgcaaagaggcgctatcagataaatgcagc tgctgccactaa

DBGET integrated database retrieval system