Podarcis muralis (common wall lizard): 114599845 Help Entry 114599845         CDS       T06059                                  Symbol HRAS Name (RefSeq) GTPase HRas isoform X1   KO K02833   GTPase HRas Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua04010   MAPK signaling pathway pmua04012   ErbB signaling pathway pmua04068   FoxO signaling pathway pmua04137   Mitophagy - animal pmua04140   Autophagy - animal pmua04144   Endocytosis pmua04150   mTOR signaling pathway pmua04210   Apoptosis pmua04218   Cellular senescence pmua04370   VEGF signaling pathway pmua04371   Apelin signaling pathway pmua04510   Focal adhesion pmua04540   Gap junction pmua04625   C-type lectin receptor signaling pathway pmua04810   Regulation of actin cytoskeleton pmua04910   Insulin signaling pathway pmua04912   GnRH signaling pathway pmua04916   Melanogenesis pmua05132   Salmonella infection Brite KEGG Orthology (KO) [BR:pmua00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     114599845 (HRAS)    04012 ErbB signaling pathway     114599845 (HRAS)    04370 VEGF signaling pathway     114599845 (HRAS)    04371 Apelin signaling pathway     114599845 (HRAS)    04068 FoxO signaling pathway     114599845 (HRAS)    04150 mTOR signaling pathway     114599845 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     114599845 (HRAS)    04140 Autophagy - animal     114599845 (HRAS)    04137 Mitophagy - animal     114599845 (HRAS)   09143 Cell growth and death    04210 Apoptosis     114599845 (HRAS)    04218 Cellular senescence     114599845 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     114599845 (HRAS)    04540 Gap junction     114599845 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     114599845 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     114599845 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     114599845 (HRAS)    04912 GnRH signaling pathway     114599845 (HRAS)    04916 Melanogenesis     114599845 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     114599845 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmua04131]     114599845 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmua04147]     114599845 (HRAS)    04031 GTP-binding proteins [BR:pmua04031]     114599845 (HRAS) Membrane trafficking [BR:pmua04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     114599845 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     114599845 (HRAS) Exosome [BR:pmua04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    114599845 (HRAS)   Exosomal proteins of colorectal cancer cells    114599845 (HRAS) GTP-binding proteins [BR:pmua04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     114599845 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin DUF6974 Ldh_1_N CbiA Motif Other DBs NCBI-GeneID:  114599845 NCBI-ProteinID:  XP_028591457 UniProt:  A0A670HMJ4 LinkDB All DBs Position 1:79586095..79651650 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctggtggtagttggggcaggaggcgtagggaaaagtgctttgacc attcagcttatccagaaccattttgttgatgagtatgatcccacgatagaggattcctac agaaagcaagtcgtcattgatggagagacctgtttgttagacatcttggacacagcaggc caagaagagtacagtgccatgcgagaccagtacatgcggacaggagaaggcttcctttgt gtctttgctattaacaacaccaagtcctttgaagacattcatcagtacagggagcagatc aagagggtgaaggactctgatgatgtcccgatggtattggtgggaaataagtgtgacctt ccagcccggactgtggaaacccggcaagcccaggagctggctcggagctatgggattccc tacatagagacatcggccaagactagacagggagttgaagatgccttctatactttagtg cgggagatccggcagcacaaactacgcaaattgaatcccccagatgaaagtggcccaggc tgcatgaattgtaaatgtgtgatatcatga

DBGET integrated database retrieval system