Podarcis muralis (common wall lizard): 114601892 Help Entry 114601892         CDS       T06059                                  Name (RefSeq) metallothionein-like   KO K14739   metallothionein 1/2 Organism pmua  Podarcis muralis (common wall lizard) Brite KEGG Orthology (KO) [BR:pmua00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmua03019]     114601892    03029 Mitochondrial biogenesis [BR:pmua03029]     114601892 Messenger RNA biogenesis [BR:pmua03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      114601892 Mitochondrial biogenesis [BR:pmua03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     114601892 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  114601892 NCBI-ProteinID:  XP_028595338 LinkDB All DBs Position 8:complement(39672486..39675637) Genome browser AA seq 63 aa AA seqDB search MDPQDCACATGGSCSCAGSCKCKNCKCTSCKKSCCSCCPAGCAKCAQNCVCKEPLSDKCS CCT NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggatcctcaggactgcgcttgcgccactggtggctcttgttcctgtgccggctcctgc aaatgcaaaaattgcaaatgcacttcatgcaaaaaaagctgctgctcttgttgcccagct ggatgcgccaaatgtgctcagaattgtgtctgcaaagagccactgtcggataaatgcagc tgctgcacctaa

DBGET integrated database retrieval system