Podarcis muralis (common wall lizard): 114602003 Help Entry 114602003         CDS       T06059                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism pmua  Podarcis muralis (common wall lizard) Pathway pmua03030   DNA replication pmua03410   Base excision repair pmua03420   Nucleotide excision repair pmua03430   Mismatch repair pmua03440   Homologous recombination Brite KEGG Orthology (KO) [BR:pmua00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     114602003 (POLD4)    03410 Base excision repair     114602003 (POLD4)    03420 Nucleotide excision repair     114602003 (POLD4)    03430 Mismatch repair     114602003 (POLD4)    03440 Homologous recombination     114602003 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:pmua03032]     114602003 (POLD4)    03400 DNA repair and recombination proteins [BR:pmua03400]     114602003 (POLD4) DNA replication proteins [BR:pmua03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     114602003 (POLD4) DNA repair and recombination proteins [BR:pmua03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       114602003 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      114602003 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  114602003 NCBI-ProteinID:  XP_028595543 LinkDB All DBs Position 1:complement(85620716..85638304) Genome browser AA seq 110 aa AA seqDB search MGRKRLITDSFQVVKKRKRDSKETKKAQSPLHDAVTVQAVQDTAHPDQLETLKQFDLSWQ YGPCTGITRLQRWERAELLGLNPPAMVRELLEKHNKDPLVTYSLWHGYCL NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atgggcaggaaacggctaatcacagactccttccaagtggtgaagaagaggaaaagagac agtaaggaaacaaagaaggctcagagcccactccatgacgcagtgacagtccaggcagtc caagatactgcacatccagaccagctggagacactaaagcaatttgacctcagctggcag tacggcccctgtacaggaatcacccgtttgcagcgctgggagagggcagagttactgggt ctcaacccccctgctatggtgcgggaattgctagagaagcacaacaaggaccctctcgtt acatacagcctgtggcatggatattgcctctga

DBGET integrated database retrieval system