KEGG   Podarcis muralis (common wall lizard): 114606638
Entry
114606638         CDS       T06059                                 
Symbol
DIRAS2
Name
(RefSeq) GTP-binding protein Di-Ras2
  KO
K07841  DIRAS family, GTP-binding Ras-like 2
Organism
pmua  Podarcis muralis (common wall lizard)
Brite
KEGG Orthology (KO) [BR:pmua00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pmua04031]
    114606638 (DIRAS2)
GTP-binding proteins [BR:pmua04031]
 Small (monomeric) G-proteins
  Ras Family
   Di-Ras [OT]
    114606638 (DIRAS2)
SSDB
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 RhoGAP_pG1_pG2 MeaB nSTAND1 SRPRB AAA_16 AAA_24 FeoB_N MIT_C
Other DBs
NCBI-GeneID: 114606638
NCBI-ProteinID: XP_028604920
UniProt: A0A670JQG6
LinkDB
Position
11:complement(56048340..56082795)
AA seq 199 aa
MPEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDSYIPTIEDTYRQVISCDKSICTLQIT
DTTGSHQFPAMQRLSISKGHAFILVYSVTSRQSLEELKPIYEQICQIKGDIDSIPIMLVG
NKNDEDHNREVQTNDGEALAKKWKCAFMETSAKMNHNVKELFQELLNLEKRRTVSLQIDG
KKSKQQKRKEKLKGKCVIM
NT seq 600 nt   +upstreamnt  +downstreamnt
atgcctgaacaaagcaatgattacagggtggtggtgtttggagcaggaggagttggcaag
agttccttggtcctgagatttgttaaaggcaccttcagagacagttacatccctacaatt
gaagacacctaccggcaggtgatcagctgcgataagagcatatgcactttgcagatcact
gacacaacggggagccatcagtttcctgccatgcagcgtttgtctatttccaaaggacac
gctttcattttggtctactcagtcaccagccggcagtccttggaggaactcaagcctatc
tacgaacagatctgccaaatcaaaggggatatagacagcatcccaatcatgctggtgggg
aacaagaacgacgaggaccacaaccgagaggtacagaccaacgatggagaagccctggcc
aaaaagtggaagtgtgccttcatggagacctctgccaagatgaaccacaatgtgaaggag
ttgttccaggagctgctgaacttggagaaacgcaggactgtgagcttacagattgacggc
aaaaaaagcaagcaacagaaaaggaaagagaagctgaaaggcaaatgtgtcattatgtga

DBGET integrated database retrieval system