Petrimonas mucosa: ING2E5A_0961 Help Entry ING2E5A_0961      CDS       T04553                                  Name (GenBank) 4Fe-4S binding domain protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism pmuc  Petrimonas mucosa Pathway pmuc00020   Citrate cycle (TCA cycle) pmuc00720   Other carbon fixation pathways pmuc01100   Metabolic pathways pmuc01110   Biosynthesis of secondary metabolites pmuc01120   Microbial metabolism in diverse environments pmuc01200   Carbon metabolism pmuc01210   2-Oxocarboxylic acid metabolism Module pmuc_M00009   Citrate cycle (TCA cycle, Krebs cycle) pmuc_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:pmuc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     ING2E5A_0961   09102 Energy metabolism    00720 Other carbon fixation pathways     ING2E5A_0961 Enzymes [BR:pmuc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      ING2E5A_0961 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_6 Fer4_9 Fer4_16 Fer4_17 Fer4_15 LdpA_Fe-S-bd Fer4_8 Fer4_4 Fer4_18 Fer4_3 Fer4_22 Fer4_13 Motif Other DBs NCBI-ProteinID:  SCM56609 UniProt:  A0A1G4G5R8 LinkDB All DBs Position I:1159730..1159963 Genome browser AA seq 77 aa AA seqDB search MAKVQGYVVVNTQRCKGCNLCVVSCPTDVLELQPREVNDRGYHYVYMKNPGECIGCFNCG TVCPEGCLTVYRKRLDR NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcaaaagtacaaggttatgtagttgttaatacacaacgctgcaaagggtgtaacctt tgcgttgtatcgtgtccgacggatgtgttggagttacaaccgcgggaggtgaatgatcgc ggttaccattacgtttacatgaagaatccgggggagtgcatcggttgcttcaattgtggt accgtttgccccgaaggatgcctgaccgtttaccggaaacgtctggaccgataa

DBGET integrated database retrieval system