Pseudomonas mucidolens: NCTC8068_00449 Help Entry NCTC8068_00449    CDS       T08935                                  Symbol acpP_1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmud  Pseudomonas mucidolens Pathway pmud01100   Metabolic pathways pmud01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmud00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC8068_00449 (acpP_1)    00074 Mycolic acid biosynthesis     NCTC8068_00449 (acpP_1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC8068_00449 (acpP_1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C DUF1493 Motif Other DBs NCBI-ProteinID:  SQH31526 LinkDB All DBs Position 1:complement(503683..503937) Genome browser AA seq 84 aa AA seqDB search MQTRDDIFNTLRDALVELFELEPERVTLDANLYQDLEIDSIDAVDLIDHIKRQTGKKIAA EEFKAVRTVNDVVEAVYRLVQPAA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaaactcgtgacgatatcttcaacaccctgcgcgatgccttggtggaattgtttgaa ctggaacctgagcgcgtcaccctcgatgccaacctgtatcaggacctggaaatcgacagc atcgatgcggtggacctgatcgaccacatcaagcgccagaccggcaagaaaatcgccgcc gaagagttcaaggccgtacgcacggtcaatgacgtggtcgaggcggtctaccgtctggtc caaccggccgcatga

DBGET integrated database retrieval system