Pseudomonas mucidolens: NCTC8068_00450 Help Entry NCTC8068_00450    CDS       T08935                                  Symbol acpP_2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmud  Pseudomonas mucidolens Pathway pmud01100   Metabolic pathways pmud01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmud00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC8068_00450 (acpP_2)    00074 Mycolic acid biosynthesis     NCTC8068_00450 (acpP_2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC8068_00450 (acpP_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  SQH31527 LinkDB All DBs Position 1:complement(503946..504215) Genome browser AA seq 89 aa AA seqDB search MSNPNSLEHDIKTLIIEALGLEDISVDDIGNEQILFGEGLGLDSVDALELGLAIQKKYGI KIDADAKDTRNHFINVASLAAFVTARQAA NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgagcaatccaaatagccttgagcacgacataaaaacgctgatcattgaggccctgggc ctggaagacatcagcgtggacgacatcggtaacgagcaaattctgttcggcgaaggcctc ggcctggattcggtagacgccctggaactgggcctggcgatccagaaaaagtacggcatc aaaatcgacgccgacgccaaggacacccgcaatcacttcatcaacgtggccagcctcgcg gcgttcgtcacggccagacaggcagcttga

DBGET integrated database retrieval system