Pseudomonas mucidolens: NCTC8068_01461 Help Entry NCTC8068_01461    CDS       T08935                                  Symbol acpP_3 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmud  Pseudomonas mucidolens Pathway pmud01100   Metabolic pathways pmud01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmud00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC8068_01461 (acpP_3)    00074 Mycolic acid biosynthesis     NCTC8068_01461 (acpP_3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC8068_01461 (acpP_3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 TerB Ribosomal_L50 NirdL-like_HTH Motif Other DBs NCBI-ProteinID:  SQH32500 LinkDB All DBs Position 1:1601585..1601821 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVVNTASFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVTSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtcaagaaaatcgtcgccgagcaactgggcgttaaggaa gaagaagtggtcaacactgcttccttcgtagaagacctgggtgccgattcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatcccggacgaagaagct gaaaaaatcactactgttcaagctgctatcgactacgttactagccaccaggcgtaa

DBGET integrated database retrieval system