Pseudomonas mucidolens: NCTC8068_03757 Help Entry NCTC8068_03757    CDS       T08935                                  Symbol ccmD Name (GenBank) heme exporter protein CcmD   KO K02196   heme exporter protein D Organism pmud  Pseudomonas mucidolens Pathway pmud02010   ABC transporters Brite KEGG Orthology (KO) [BR:pmud00001]  09130 Environmental Information Processing   09131 Membrane transport    02010 ABC transporters     NCTC8068_03757 (ccmD)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:pmud02000]     NCTC8068_03757 (ccmD) Transporters [BR:pmud02000]  ABC transporters, prokaryotic type   ABC-2 type and other transporters    Heme transporter     NCTC8068_03757 (ccmD) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CcmD Motif Other DBs NCBI-ProteinID:  SQH34873 LinkDB All DBs Position 1:complement(4157154..4157330) Genome browser AA seq 58 aa AA seqDB search MSFASFSDFLAMGHHGLFVWTAYGICLVVLALNVAAPILARKRYLQQEARRLRRETDK NT seq 177 nt NT seq  +upstreamnt  +downstreamnt atgagtttcgcctctttcagtgattttctcgccatgggccatcacggcctgttcgtttgg acggcctatggcatttgcctggtggtgctggcgctcaacgtcgctgcgccgatcctggcc cgcaagcgttacctgcaacaagaggcgcgtcgtctgcgccgggagaccgataagtga

DBGET integrated database retrieval system