Pseudomonas multiresinivorans: G4G71_01010 Help Entry G4G71_01010       CDS       T07281                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism pmui  Pseudomonas multiresinivorans Brite KEGG Orthology (KO) [BR:pmui00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:pmui03036]     G4G71_01010 Chromosome and associated proteins [BR:pmui03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     G4G71_01010 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB SOGA1-2-like_CC Asd-4 Neuromodulin_N USHBP1_PDZ-bd Motif Other DBs NCBI-ProteinID:  QJP06522 UniProt:  A0A7Z3BGM1 LinkDB All DBs Position 217737..217946 Genome browser AA seq 69 aa AA seqDB search MEDADLHALIAKFDLLLQRLEQLKAENRLLRANEKSWREERAHLIEKNDLARQKVEAMIL RLKALEQDS NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atggaagacgccgacctgcacgcgctgatcgccaagttcgacctgctgctccagcgcctg gaacagctcaaggccgagaaccggctgctgcgggcgaacgagaaaagctggcgggaagaa cgcgcccatctgatcgagaagaacgatttggctcggcagaaggtcgaagcgatgattttg cgtcttaaagccctggagcaggactcatga

DBGET integrated database retrieval system