Pseudomonas multiresinivorans: G4G71_20080 Help Entry G4G71_20080       CDS       T07281                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmui  Pseudomonas multiresinivorans Pathway pmui01100   Metabolic pathways pmui01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmui00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G4G71_20080 (acpP)    00074 Mycolic acid biosynthesis     G4G71_20080 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G4G71_20080 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 TerB DUF1896 Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  QJP10077 UniProt:  A0A7Z3BND6 LinkDB All DBs Position complement(4440791..4441027) Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYIVAHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaagatcgttgctgagcaactcggcgttaaggaa gaagaagtcaccaacagcgcttccttcgtcgaagacctgggcgccgactcccttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccccgacgagcaagcc gaaaagatcaccaccgttcaggaagccatcgactacatcgttgcccaccaggcataa

DBGET integrated database retrieval system