Prunus mume (Japanese apricot): 103325001 Help Entry 103325001         CDS       T03196                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism pmum  Prunus mume (Japanese apricot) Pathway pmum03083   Polycomb repressive complex pmum04120   Ubiquitin mediated proteolysis pmum04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pmum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103325001    04120 Ubiquitin mediated proteolysis     103325001   09126 Chromosome    03083 Polycomb repressive complex     103325001  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmum04131]     103325001    04121 Ubiquitin system [BR:pmum04121]     103325001    03036 Chromosome and associated proteins [BR:pmum03036]     103325001 Membrane trafficking [BR:pmum04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103325001 Ubiquitin system [BR:pmum04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      103325001    Cul7 complex      103325001 Chromosome and associated proteins [BR:pmum03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103325001   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103325001 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 DarP DUF5069 Motif Other DBs NCBI-GeneID:  103325001 NCBI-ProteinID:  XP_008225342 UniProt:  A0ABM0NIL2 LinkDB All DBs Position LG3:3579874..3580335 Genome browser AA seq 153 aa AA seqDB search MSSSKSRVFRLRCSNDEIIEVNEAAAVLCETIKNMVEEGCEGDEISVPNVTAEILGKVME WCKKHAKGKETKEELEEWDAEFLNVDQAVLYHILIAADYLYNKELVAQVTQKVADMIKGK KSDEIREVFKLKNDMPPELVKEIIDGNPSVDFM NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atgtcctcgtcaaagagtagggttttcagattgcggtgttcgaatgacgaaataattgaa gtaaatgaggctgcggcggtactttgtgaaaccatcaagaacatggtggaggaaggctgt gagggcgacgagatttcagtaccaaacgtgactgccgaaatcctaggcaaggtgatggag tggtgcaaaaagcatgcaaagggtaaagagactaaagaggaactcgaagagtgggacgct gagtttcttaatgttgatcaagcagttttgtaccatatcttgattgccgcggactatcta tacaacaaggaattggtggctcaagtgactcaaaaggttgcagatatgatcaagggaaag aaaagtgacgagattcgcgaagtgtttaagctcaagaatgatatgccaccagagctcgta aaagaaataatcgatggcaacccttcggtagatttcatgtaa

DBGET integrated database retrieval system