Prunus mume (Japanese apricot): 103332477 Help Entry 103332477         CDS       T03196                                  Name (RefSeq) SKP1-like protein 13   KO K03094   S-phase kinase-associated protein 1 Organism pmum  Prunus mume (Japanese apricot) Pathway pmum03083   Polycomb repressive complex pmum04120   Ubiquitin mediated proteolysis pmum04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pmum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103332477    04120 Ubiquitin mediated proteolysis     103332477   09126 Chromosome    03083 Polycomb repressive complex     103332477  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmum04131]     103332477    04121 Ubiquitin system [BR:pmum04121]     103332477    03036 Chromosome and associated proteins [BR:pmum03036]     103332477 Membrane trafficking [BR:pmum04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103332477 Ubiquitin system [BR:pmum04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      103332477    Cul7 complex      103332477 Chromosome and associated proteins [BR:pmum03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103332477   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103332477 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  103332477 NCBI-ProteinID:  XP_008233443 LinkDB All DBs Position LG5:complement(18663813..18664244) Genome browser AA seq 143 aa AA seqDB search MSSSSASKSRVVRLRSANNEIFEVEEAIVALSEPIKNLIDVIGVNHVIPMPDVRSKTLAM VIEWCKYHAASDQGPRRNTKELIKEWEEELDQADVVIDLLCTASFLCIKDLQDQMFQRVA DLIKVKTLEEICELFTVKNDFSS NT seq 432 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcgtcgtcggcatcaaagagtagggttgtgaggttgaggagcgcaaacaatgaa atatttgaagtagaagaagcaattgtagcactgtccgagcccatcaaaaacctcatcgac gtcatcggtgtcaaccatgtgataccaatgcccgacgtgaggtccaaaaccctagccatg gtgatagagtggtgcaagtaccatgctgcttctgatcagggccctagaagaaacactaaa gaactcatcaaagagtgggaggaagagctcgaccaagctgacgtcgtcattgatctctta tgcactgcaagctttctctgcatcaaggacttgcaagatcaaatgtttcaaagggttgcc gatttgattaaagtgaagacacttgaggagatttgcgaattgtttaccgtcaaaaacgat ttttcttcctag

DBGET integrated database retrieval system