Prunus mume (Japanese apricot): 103334186 Help Entry 103334186         CDS       T03196                                  Name (RefSeq) calmodulin-like protein 11   KO K02183   calmodulin Organism pmum  Prunus mume (Japanese apricot) Pathway pmum04016   MAPK signaling pathway - plant pmum04070   Phosphatidylinositol signaling system pmum04075   Plant hormone signal transduction pmum04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pmum00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     103334186    04070 Phosphatidylinositol signaling system     103334186    04075 Plant hormone signal transduction     103334186  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     103334186  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pmum01009]     103334186   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmum04131]     103334186    03036 Chromosome and associated proteins [BR:pmum03036]     103334186   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmum04147]     103334186 Protein phosphatases and associated proteins [BR:pmum01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103334186 Membrane trafficking [BR:pmum04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103334186 Chromosome and associated proteins [BR:pmum03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103334186 Exosome [BR:pmum04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103334186 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_9 SPARC_Ca_bdg EH EF_EFCAB10_C Dockerin_1 SPEF2_C RNA_pol_Rpb4 CdiI_ImmP DUF7646 Imm51 SDG2_C MinC_N_1 SurA_N_3 Motif Other DBs NCBI-GeneID:  103334186 NCBI-ProteinID:  XP_008235348 LinkDB All DBs Position LG6:1961652..1962764 Genome browser AA seq 148 aa AA seqDB search MAEALTEAQISEFQEAFCLIDKDSDGLISLEELASVIQSLDEHPTKEEIQDMINEVGAEG NGTIDCEEFLNIMARKMKENVAEELKEAFKVFDRDQDGYISAYELRQVMINLGERLSDEE AEQMIREADVDGDGLVSYEEFARMMMLS NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcagaggcattaacagaagctcagatttctgagttccaggaagccttttgtctaatt gacaaggattcagatggcctaatttccttggaagaactagcgtcagtgatccaatcactg gacgagcatcccacaaaagaagaaatccaagacatgatcaatgaggttggtgctgaggga aatggaacaatagattgtgaagagttcttgaatattatggcaagaaagatgaaggaaaat gttgccgaggagctgaaagaagccttcaaagtatttgacagagaccaagatggctatatt tcagcctatgagttgaggcaagttatgataaacttgggagaaagattgagtgatgaggag gctgagcaaatgatcagagaggctgatgtagatggtgatggtcttgttagctatgaagaa tttgcaaggatgatgatgctcagttga

DBGET integrated database retrieval system