Prunus mume (Japanese apricot): 103337077 Help Entry 103337077         CDS       T03196                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism pmum  Prunus mume (Japanese apricot) Pathway pmum04016   MAPK signaling pathway - plant pmum04070   Phosphatidylinositol signaling system pmum04075   Plant hormone signal transduction pmum04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:pmum00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     103337077    04070 Phosphatidylinositol signaling system     103337077    04075 Plant hormone signal transduction     103337077  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     103337077  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:pmum01009]     103337077   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmum04131]     103337077    03036 Chromosome and associated proteins [BR:pmum03036]     103337077   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmum04147]     103337077 Protein phosphatases and associated proteins [BR:pmum01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      103337077 Membrane trafficking [BR:pmum04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     103337077 Chromosome and associated proteins [BR:pmum03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      103337077 Exosome [BR:pmum04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    103337077 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_9 EF-hand_5 EF-hand_8 EF_EFCAB10_C AIF-1 UPF0154 MTIP_N ERAP1_C Acetyltransf_11 Motif Other DBs NCBI-GeneID:  103337077 NCBI-ProteinID:  XP_008238453 LinkDB All DBs Position LG7:complement(4981594..4982330) Genome browser AA seq 83 aa AA seqDB search MDSDLTDEQVEELKQAFDIFDKDGSGTITTDELRNVLTSLGQTPSEDELEEFLQQMGGDN GMVRFDQYLIFMEKLMYPNGAVE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggattccgatttgactgatgagcaagtcgaggagctcaagcaagccttcgacattttt gacaaggatggcagtggcactatcactaccgatgagctgcgcaatgtattgacctcacta gggcaaaccccatctgaggacgaactggaagaatttcttcaacagatgggtggtgataat gggatggttcgctttgatcaatacttgatcttcatggaaaaattaatgtaccctaatggt gcggttgaatga

DBGET integrated database retrieval system