Prunus mume (Japanese apricot): 103338312 Help Entry 103338312         CDS       T03196                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism pmum  Prunus mume (Japanese apricot) Pathway pmum04145   Phagosome pmum04148   Efferocytosis pmum04517   IgSF CAM signaling pmum04518   Integrin signaling pmum04620   Toll-like receptor signaling pathway pmum05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:pmum00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     103338312    04518 Integrin signaling     103338312  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     103338312    04148 Efferocytosis     103338312  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     103338312  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     103338312  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmum04131]     103338312   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pmum04147]     103338312    04031 GTP-binding proteins [BR:pmum04031]     103338312 Membrane trafficking [BR:pmum04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     103338312  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     103338312   Macropinocytosis    Ras GTPases     103338312  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     103338312 Exosome [BR:pmum04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    103338312   Exosomal proteins of other body fluids (saliva and urine)    103338312   Exosomal proteins of colorectal cancer cells    103338312   Exosomal proteins of bladder cancer cells    103338312 GTP-binding proteins [BR:pmum04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     103338312 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  103338312 NCBI-ProteinID:  XP_008239729 UniProt:  A0ABM0PHK3 LinkDB All DBs Position LG7:complement(13761538..13764951) Genome browser AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENVLKKWIPELQHYAPGVPVVLAGT KLDLREDKHYLADHPGLVPVTTAQGEELRKQIGASFYIECSSKTQQNVKAVFDAAIRVVI KPPQKQKEKKQKARQGCLVNILCGRRLVCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcgtcaagcgcttcaaggttcatcaagtgtgtgacggtgggagatggagctgtgggg aagacctgtatgcttatttgctacaccagcaacaaatttcccactgattatatacccact gtgtttgataacttcagcgctaatgtggtggttgaaggcaccaccgtgaacttaggcctc tgggacaccgctgggcaagaggattacaatcgattaaggccgttgagctacagaggggca gatgtctttgtcttagctttctcattagttagtcgtgcaagctatgagaacgtgctgaaa aagtggatccctgaactccagcattatgctcccggagtcccagttgtacttgctggcacc aaattagatcttcgagaggataagcactatttggctgatcacccaggattggtacctgtg accactgcacagggcgaggagctgcgcaagcagattggtgcttcattttatatagaatgc agctcaaaaactcagcagaatgtgaaagcagtttttgatgctgcgatcagggtggttatc aagccaccacagaagcagaaggagaagaagcaaaaggcacgtcaaggatgcctagtcaac atcctttgtggaaggaggctagtgtgtctcaaatga

DBGET integrated database retrieval system