Prunus mume (Japanese apricot): 103343563 Help Entry 103343563         CDS       T03196                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism pmum  Prunus mume (Japanese apricot) Pathway pmum03083   Polycomb repressive complex pmum04120   Ubiquitin mediated proteolysis pmum04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:pmum00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     103343563    04120 Ubiquitin mediated proteolysis     103343563   09126 Chromosome    03083 Polycomb repressive complex     103343563  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pmum04131]     103343563    04121 Ubiquitin system [BR:pmum04121]     103343563    03036 Chromosome and associated proteins [BR:pmum03036]     103343563 Membrane trafficking [BR:pmum04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     103343563 Ubiquitin system [BR:pmum04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      103343563    Cul7 complex      103343563 Chromosome and associated proteins [BR:pmum03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      103343563   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      103343563 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ DUF615 Motif Other DBs NCBI-GeneID:  103343563 NCBI-ProteinID:  XP_008245448 LinkDB All DBs Position Unknown AA seq 156 aa AA seqDB search MASVEMKKITLKSDDGEIFEVEEAVAMQSQTIRHMVEDDCADGPIPLPNVTSNIVAKVIE YCKKKHEEDADGEKNKEDIKNWDAAFVKVDQSTLFDLILAANYLNIKSLLDLTCQTVADM IKGKTPEEIREIFNIKNDFTPEEEQEVRNENRWAFE NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcctccgttgagatgaagaagataacactgaagagcgacgacggtgagatcttcgag gtggaggaggctgtggccatgcagtcacagaccatcaggcacatggtggaggacgactgc gccgatggcccaatacctctgccgaacgtgaccagcaacatcgtagcgaaggtgatcgag tactgcaagaagaaacatgaagaggatgccgatggcgagaagaacaaagaggacattaag aactgggatgctgcgttcgtgaaggtggaccagagtactctgtttgacttaatcttggct gcaaactatctcaatatcaagagcctgctggatttgacctgccagactgtggcggacatg atcaagggaaagacacctgaagagatccgtgagatcttcaacatcaagaatgacttcacg cctgaggaagaacaggaggttcgtaatgagaaccgatgggcattcgagtga

DBGET integrated database retrieval system