Pedobacter mucosus: LOK61_19135 Help Entry LOK61_19135       CDS       T08291                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmuo  Pedobacter mucosus Pathway pmuo01100   Metabolic pathways pmuo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmuo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LOK61_19135    00074 Mycolic acid biosynthesis     LOK61_19135   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LOK61_19135 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF1493 PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  UKT63872 LinkDB All DBs Position complement(4577745..4577981) Genome browser AA seq 78 aa AA seqDB search MSDIASRVKAIIVEKLGVDESEVTPEASFTNDLGADSLDTVELIMEFEKEFNVAIPDDQA ETIGTVGQAIAYLEKNVK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgtctgatattgcttcaagagttaaggctattatcgtagaaaaactaggtgtagacgaa agcgaagttacgccagaggcttctttcaccaacgatttaggtgcagattctttagatacc gtagaattaattatggaatttgaaaaagaattcaacgtagctattcctgatgatcaagct gaaaccattggtacagttggtcaagcaatcgcttatttggaaaaaaacgttaaatag

DBGET integrated database retrieval system