Paracoccus mutanolyticus: DPM13_00290 Help Entry DPM13_00290       CDS       T05551                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmut  Paracoccus mutanolyticus Pathway pmut01100   Metabolic pathways pmut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DPM13_00290    00074 Mycolic acid biosynthesis     DPM13_00290   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DPM13_00290 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AWX92269 UniProt:  A0ABM6WP00 LinkDB All DBs Position complement(64915..65148) Genome browser AA seq 77 aa AA seqDB search MSDIADRVKKIVVEHLGVDEDKVTESASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFIQGAV NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgatcgcgtgaagaaaatcgtcgtcgagcacctgggcgtggacgag gacaaggtgacggaaagcgcctcgttcatcgacgacctcggcgccgactcgctcgacacg gtcgagctggtcatggccttcgaggaagaattcggcatcgaaatccccgatgacgcggcc gaaaccatccagaccttcggcgatgcggtgaagttcatccagggcgcggtctga

DBGET integrated database retrieval system