Paracoccus mutanolyticus: DPM13_17535 Help Entry DPM13_17535       CDS       T05551                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmut  Paracoccus mutanolyticus Pathway pmut01100   Metabolic pathways pmut01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmut00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     DPM13_17535    00074 Mycolic acid biosynthesis     DPM13_17535   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     DPM13_17535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Motif Other DBs NCBI-ProteinID:  AWX94548 LinkDB All DBs Position 3215192..3215452 Genome browser AA seq 86 aa AA seqDB search MTDVRDRIIQIIAEQAMLEPSELRPELSPQEIGIDSLGLVESIFAIEEEFDISVPFNANE PEKSEFDISTLGSIIAAVEKLVAEKA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgacagacgtgcgcgaccgcatcatccagatcatcgccgaacaggccatgctggagcct tccgaactccggcccgagctgtcgccgcaggaaatcggcatcgacagcctggggctggtc gagtcgatctttgccatcgaggaagagttcgacatctctgtccccttcaacgccaacgag cccgagaagtccgagttcgacatctcgacgctgggctcgatcatcgcggccgtcgaaaag ctggtcgctgaaaaggcatga

DBGET integrated database retrieval system