KEGG   Pseudomonas muyukensis: KSS95_00425
Entry
KSS95_00425       CDS       T07704                                 
Symbol
fdxH
Name
(GenBank) formate dehydrogenase subunit beta
  KO
K00124  formate dehydrogenase iron-sulfur subunit
Organism
pmuy  Pseudomonas muyukensis
Pathway
pmuy00630  Glyoxylate and dicarboxylate metabolism
pmuy00680  Methane metabolism
pmuy01100  Metabolic pathways
pmuy01120  Microbial metabolism in diverse environments
pmuy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pmuy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    KSS95_00425 (fdxH)
  09102 Energy metabolism
   00680 Methane metabolism
    KSS95_00425 (fdxH)
SSDB
Motif
Pfam: Fer4_11 Form-deh_trans Fer4_7 Fer4_2 Fer4_9 Fer4_10 Fer4_6 Fer4_21 Fer4 Fer4_4 Fer4_17 Fer4_15 Fer4_3 Fer4_8 Fer4_22 Fer4_16 Fer4_13
Other DBs
NCBI-ProteinID: QXH35331
UniProt: A0ABX8M8B2
LinkDB
Position
complement(84488..85438)
AA seq 316 aa
MASQDIIARSATTTVPPSVRQQQEVAKLIDTTKCIGCKACQVACSEWNELRDEVGHNHGT
YDNPQDLTAETWTLMRFTEHERDDGNLEWLIRKDGCMHCAEPGCLKACPSPGAIIKHANG
IVDFNQDHCIGCGYCITGCPFNIPRISQKDHKAYKCTLCSDRVSVGLEPACVKTCPTGAI
VFGSKDEMKVHADERIVDLKSRGYANAGLYDPDGVGGTHVMYVLHHADTPRLYAGLPDQP
VISPLVGLWKGFSKPLALLAMGAAVVAGFFHYVRVGPQRVEEDEHPPTGDASVHQVDPAV
HVYDPKRPGGEGEQRP
NT seq 951 nt   +upstreamnt  +downstreamnt
atggccagccaagacatcattgcccgctcggccaccaccaccgtgccgccctcggtacgc
cagcagcaggaagtcgccaagctgatcgacaccaccaagtgcatcggctgcaaggcctgc
caggtggcgtgttcggagtggaacgaactgcgtgacgaggtcggccacaaccacggcacc
tacgacaacccccaggacctcacggccgagacctggaccctgatgcgcttcaccgagcac
gagcgcgacgacggcaacctggagtggctgatccgcaaggacggctgcatgcactgcgcc
gagcccggttgcctgaaggcctgcccgagcccgggggcgatcatcaagcacgccaacggt
atcgtcgatttcaaccaggaccattgcatcggttgcggctactgcatcaccggctgcccg
ttcaacatcccgcgcatctcgcagaaggaccacaaggcatacaagtgcaccctgtgttcc
gaccgcgtgagcgtgggcctggagccggcctgcgtgaagacctgcccgaccggggccatc
gtcttcggcagcaaggatgagatgaaggtgcatgccgacgagcgcatcgtcgacctcaag
tcgcgcggttatgccaacgccgggttgtacgacccggatggcgtcggcggcacccatgtg
atgtacgtgctgcaccacgccgatacccccaggttgtacgccggcctgccggaccaaccg
gtgatcagcccgctggtggggctgtggaagggcttcagcaagccgctggcgctgctggcc
atgggcgcggcggtggtggctgggttcttccactatgtgcgggtggggccgcagcgggtc
gaggaggatgagcatccgccgacgggcgatgccagcgtccaccaggtggacccggcggtg
catgtctatgatccgaagcgcccgggcggcgaaggggagcagcggccatga

DBGET integrated database retrieval system