Pseudomonas muyukensis: KSS95_10395 Help Entry KSS95_10395       CDS       T07704                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmuy  Pseudomonas muyukensis Pathway pmuy01100   Metabolic pathways pmuy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmuy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KSS95_10395 (acpP)    00074 Mycolic acid biosynthesis     KSS95_10395 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KSS95_10395 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  QXH37207 UniProt:  A0ABX8MDR1 LinkDB All DBs Position 2299595..2299831 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVKNESSFVEDLGADSLDTVELVMALEEEFETEIPDEEA EKITTVQAAIDYVNSHQA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgccgagcaactgggcgtcaaggaa gaggaagtcaagaacgaatcttccttcgttgaggacctgggtgccgactcgcttgacacc gttgagctggtgatggctctggaagaggaattcgagaccgaaatccctgacgaagaagcc gagaagatcactaccgttcaagccgctatcgactacgtcaacagccaccaggcctaa

DBGET integrated database retrieval system