Paenibacillus mucilaginosus K02: B2K_00475 Help Entry B2K_00475         CDS       T02041                                  Name (GenBank) anti-sigma-28 factor FlgM   KO K02398   negative regulator of flagellin synthesis FlgM Organism pmw  Paenibacillus mucilaginosus K02 Pathway pmw02020   Two-component system pmw02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:pmw00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     B2K_00475  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     B2K_00475  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:pmw02035]     B2K_00475 Bacterial motility proteins [BR:pmw02035]  Flagellar system   Flagellar assembly proteins    Others     B2K_00475 SSDB OrthologParalogGFIT Motif Pfam:  FlgM MboIIR_mid Motif Other DBs NCBI-ProteinID:  AFH59218 UniProt:  I0BA21 LinkDB All DBs Position 100618..100899 Genome browser AA seq 93 aa AA seqDB search MKINGSNQMNAISRYKKTAETQQAAAPAKAKPKDQVEISSQAKELLESQSIKSAGAAADA RAEKIQSLKQAVQSGTYSVDAGKLAERLLPYLT NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaaatcaacggatccaaccaaatgaatgccatcagccgctacaagaaaacggctgaa acccagcaagccgccgctccggccaaagcgaagccgaaggaccaggtggagatctcgagt caagcgaaagagcttctcgaatcccaatccatcaagtccgccggtgccgcagccgatgcc cgcgcagagaagatccaatcgctgaaacaggcggttcaatcgggaacttattccgtggat gcaggcaagctggctgaacgactgctgccctatctgacctaa

DBGET integrated database retrieval system