Paenibacillus mucilaginosus K02: B2K_15910 Help Entry B2K_15910         CDS       T02041                                  Name (GenBank) prohead protease   KO K03116   sec-independent protein translocase protein TatA Organism pmw  Paenibacillus mucilaginosus K02 Pathway pmw03060   Protein export pmw03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:pmw00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     B2K_15910  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     B2K_15910  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:pmw02044]     B2K_15910 Secretion system [BR:pmw02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    B2K_15910 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Motif Other DBs NCBI-ProteinID:  AFH62188 UniProt:  I0BIJ1 LinkDB All DBs Position 3629651..3629848 Genome browser AA seq 65 aa AA seqDB search MPFGNIGIGGLLLILVVVLIMFGPSKLPELGRAFGRTLSEFKSSTRGLMSEDKDTEGKPE DTKKS NT seq 198 nt NT seq  +upstreamnt  +downstreamnt ttgccatttggcaatatcgggatcggcggactgctgctgattcttgtcgtcgtactcatc atgttcggaccgtccaagctccccgaactcggcagggccttcggccgcacgctcagcgaa ttcaagagttcgacccgcgggctgatgtccgaggacaaggatacggagggcaagccggag gatacgaagaagtcctga

DBGET integrated database retrieval system