Paenibacillus mucilaginosus K02: B2K_25295 Help Entry B2K_25295         CDS       T02041                                  Name (GenBank) hypothetical protein   KO K06371   developmental checkpoint coupling sporulation initiation to replication initiation Organism pmw  Paenibacillus mucilaginosus K02 Brite KEGG Orthology (KO) [BR:pmw00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     B2K_25295 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Sda Motif Other DBs NCBI-ProteinID:  AFH63963 UniProt:  I0BNL6 LinkDB All DBs Position 6031580..6031717 Genome browser AA seq 45 aa AA seqDB search MNHSLEKLSDEDLLEAYLLALDLKLEPSFIRLLRDEIDRRQLHMD NT seq 138 nt NT seq  +upstreamnt  +downstreamnt ttgaatcattcccttgaaaaattatcggatgaagatcttctggaggcctatctcctggct ctcgatttgaaactggagcccagcttcatccgcttgctgcgggatgaaatcgaccgcaga caactccatatggattga

DBGET integrated database retrieval system