Persephonella marina: PERMA_1428 Help Entry PERMA_1428        CDS       T00870                                  Symbol hfq_2 Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism pmx  Persephonella marina Pathway pmx02024   Quorum sensing pmx03018   RNA degradation Brite KEGG Orthology (KO) [BR:pmx00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     PERMA_1428 (hfq_2)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     PERMA_1428 (hfq_2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:pmx03019]     PERMA_1428 (hfq_2)    03036 Chromosome and associated proteins [BR:pmx03036]     PERMA_1428 (hfq_2) Messenger RNA biogenesis [BR:pmx03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      PERMA_1428 (hfq_2) Chromosome and associated proteins [BR:pmx03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     PERMA_1428 (hfq_2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Rad1 Motif Other DBs NCBI-ProteinID:  ACO03153 UniProt:  C0QRA0 LinkDB All DBs Position 1345523..1345762 Genome browser AA seq 79 aa AA seqDB search MAKKKGRLQEQFLNAIRKEKVRVNVYLVNGVKLEGKIRYFDPFTILLKEGPRQVLVYKHA ITTVIPKREIEFELEEEQQ NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggcaaagaagaagggaaggttgcaggaacagtttttgaacgctataagaaaggaaaag gtaagggttaatgtgtatcttgtgaacggtgttaagctggaaggaaagataaggtacttt gatcctttcacaattcttttaaaagagggaccaagacaggttttagtatataaacatgca ataacaacagtcattcctaaaagagaaatagagtttgagttagaagaagaacagcagtaa

DBGET integrated database retrieval system