Ectopseudomonas mendocina ymp: Pmen_1629 Help Entry Pmen_1629         CDS       T00510                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism pmy  Ectopseudomonas mendocina ymp Pathway pmy01100   Metabolic pathways pmy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:pmy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Pmen_1629    00074 Mycolic acid biosynthesis     Pmen_1629   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Pmen_1629 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C TerB DUF1896 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ABP84393 UniProt:  A4XSS7 LinkDB All DBs Position 1792601..1792837 Genome browser AA seq 78 aa AA seqDB search MSTIEERVKKIVAEQLGVKEEEVTNSASFVEDLGADSLDTVELVMALEEEFETEIPDEQA EKITTVQEAIDYVTAHAQ NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgttgctgagcaacttggcgtcaaggaa gaggaagtaaccaacagtgcttccttcgttgaagacctgggtgccgactctcttgacacc gttgagctggtgatggctctcgaggaagaattcgagaccgagatcccggacgagcaagct gagaagatcaccaccgttcaggaagccatcgactacgtgactgcccacgcgcaataa

DBGET integrated database retrieval system